PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G19430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 262aa    MW: 29399.1 Da    PI: 7.472
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G19430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+  +  +G  +W++++   g+ R++k+c++rw +yl
  LPERR08G19430.1 14 RGPWTAEEDKKLISFILTHGRCCWRAVPMLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding56.56.2e-1869111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        T++E++l vd++++lG++ W++Ia++++ gRt++++k++w+++
  LPERR08G19430.1  69 LLTADEEQLVVDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                      569*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.231961IPR017930Myb domain
SuperFamilySSF466895.59E-2711108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.02E-91661No hitNo description
PROSITE profilePS5129428.16262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2564117IPR009057Homeodomain-like
SMARTSM007179.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1569111IPR001005SANT/Myb domain
CDDcd001671.53E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRQPCCDKK RVKRGPWTAE EDKKLISFIL THGRCCWRAV PMLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TADEEQLVVD LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQHLA NTKAFSQAGT STQSTVTTES AKSNDIAYPS DPKGGCSRDM SVPTDSMEQS  180
SRNSSSHGLD PLVNWLLEAE LPAEEQWLNF MSSNEDDFSG IVKQSPWDGS TTDWLLDYQD  240
FSMDDSSLID GARIQNSDGS NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047040.0AP004704.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0544G09.
GenBankAP0062650.0AP006265.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1112_E06.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650716.11e-180PREDICTED: protein ODORANT1
RefseqXP_015650715.11e-180PREDICTED: protein ODORANT1
RefseqXP_015650714.11e-180PREDICTED: protein ODORANT1
SwissprotQ50EX62e-84ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D9XAJ20.0A0A0D9XAJ2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026529-PA1e-179(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-82myb domain protein 42